PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo29G0009400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 219aa    MW: 23598.8 Da    PI: 9.5191
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo29G0009400genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.81.2e-3897155260
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                      ++k+l+cprC+s +tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grr++k 
  Spipo29G0009400  97 PDKILPCPRCNSLDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRRSKP 155
                      68999***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3094154IPR003851Zinc finger, Dof-type
PfamPF027016.3E-3299154IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.77101155IPR003851Zinc finger, Dof-type
PROSITE patternPS013610103139IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MMVQGKDPAI KLFGRTIPVV GRGAVGEAVR DSDPSLADGA VGESKIGFRG RKNAAAKEGL  60
LEKPRGRDQI EPSLPSAEEK EQGEAEGSGQ EKTLKRPDKI LPCPRCNSLD TKFCYYNNYN  120
VNQPRHFCKN CQRYWTAGGT MRNVPVGAGR RRSKPSPPPE LFPRRFPAWG SSRGAGLELE  180
WSATVAMDEP LEHHGKLWPA AAAATAAAAT FGLGEVLV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006829835.15e-49PREDICTED: cyclic dof factor 2
SwissprotQ8LFV33e-43CDF3_ARATH; Cyclic dof factor 3
TrEMBLW1NNG26e-49W1NNG2_AMBTC; Uncharacterized protein
STRINGGSMUA_Achr11P15580_0019e-48(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.18e-43cycling DOF factor 3